PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID BGIOSGA014540-PA
Common NameOsI_16995
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza; Oryza sativa
Family Nin-like
Protein Properties Length: 340aa    MW: 39171.7 Da    PI: 9.1355
Description Nin-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
BGIOSGA014540-PAgenomeRISView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1RWP-RK825.9e-26201250352
            RWP-RK   3 keisledlskyFslpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 
                       ++i+l d+++yF+lpi++A+++L++++++LKr+CRqy+I+RWPhRkiksl
  BGIOSGA014540-PA 201 ASITLVDIAQYFHLPIREASRTLKIGVSILKRKCRQYNIPRWPHRKIKSL 250
                       78**********************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5151919.27185270IPR003035RWP-RK domain
PfamPF020424.3E-21202250IPR003035RWP-RK domain
Sequence ? help Back to Top
Protein Sequence    Length: 340 aa     Download sequence    Send to blast
MVPAPFDRFC PGVPATEKMT RKAPGAVRSV HGYKVYGRGG RRRWERWVER EFVLTPASCR  60
EVPAPVAPPR ILPAEWRGRP AYREGQVVAA GAWRCILAFD SAAAPPRTPP PVLSPFLNPR  120
LMCVPSLYND LEKVFRFQNV EKIPKLMQCD SEEKLSSWDA RDKSSDEVHA SESDSDDDLQ  180
SGEEEKPTVQ KQRRANKKHI ASITLVDIAQ YFHLPIREAS RTLKIGVSIL KRKCRQYNIP  240
RWPHRKIKSL DSLIQDLEYV IDDGDDHDDT GDDVQQEKHK QTAEEKQEAI MALTRRKQML  300
ETEKETIQQI PAMDLKVETK QFREDVFKRR YRAKKDLAND
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1328335RRYRAKKD
Expression -- Microarray ? help Back to Top
Source ID E-value
GEO2976031790.0
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAL6066281e-155AL606628.3 Oryza sativa genomic DNA, chromosome 4, BAC clone: OSJNBa0017B10, complete sequence.
GenBankAP0149601e-155AP014960.1 Oryza sativa Japonica Group DNA, chromosome 4, cultivar: Nipponbare, complete sequence.
GenBankCP0126121e-155CP012612.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 4 sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015634161.10.0PREDICTED: protein RKD5 isoform X1
TrEMBLB8AT570.0B8AT57_ORYSI; Putative uncharacterized protein
TrEMBLB9FC010.0B9FC01_ORYSJ; Uncharacterized protein
STRINGBGIOSGA014540-PA0.0(Oryza sativa Indica Group)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP106733142
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G35590.13e-45RWP-RK domain-containing protein